Protein Info for BWI76_RS01605 in Klebsiella michiganensis M5al

Annotation: transcriptional regulatory protein ZraR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF00072: Response_reg" amino acids 8 to 115 (108 residues), 109.8 bits, see alignment E=2.5e-35 PF00158: Sigma54_activat" amino acids 141 to 307 (167 residues), 242.9 bits, see alignment E=4.5e-76 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 80.4 bits, see alignment E=4.7e-26 PF07728: AAA_5" amino acids 165 to 283 (119 residues), 31.5 bits, see alignment E=5e-11 PF02954: HTH_8" amino acids 405 to 442 (38 residues), 55.6 bits, see alignment 1e-18

Best Hits

Swiss-Prot: 100% identical to ZRAR_KLEOX: Transcriptional regulatory protein ZraR (zraR) from Klebsiella oxytoca

KEGG orthology group: None (inferred from 84% identity to eae:EAE_08230)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW36 at UniProt or InterPro

Protein Sequence (443 amino acids)

>BWI76_RS01605 transcriptional regulatory protein ZraR (Klebsiella michiganensis M5al)
MSGEQVDILVVDDDISHCTILQALLRGWGYRVALANNGLQALEKVREKVFDLVLCDIRMA
EMDGIETLKEIKTFNPSIPVLIMTAYSSVDTAVEALKSGALDYLIKPLDFDKLQLTLSEA
LAHTRLSESPVTETPAAQFGMVGDSPAMRALLNNITLVAPSDATVLIHGESGTGKELVAR
ALHASSARSRRPLVILNCAALNESLLESELFGHEKGAFTGADKRREGRFVEADGGTLFLD
EIGDISPLMQVRLLRAIQEREVQRVGSNQTLSVDVRLIAATHRDLAEEVSAGRFRQDLYY
RLNVVTIDMPPLRHRREDIPPLARYFLQRYAERNRKAVQGFTPQAMDLLIHYAWPGNIRE
LENAVERAVVLLTGEYISERELPLAITGTPVADAPHGDDSIQPLVEVEKEAILAALERTG
GNKTEAARRLGITRKTLLAKLSR