Protein Info for BWI76_RS01600 in Klebsiella michiganensis M5al

Annotation: sensor protein ZraS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details PF17203: sCache_3_2" amino acids 43 to 119 (77 residues), 29 bits, see alignment E=1.6e-10 PF00512: HisKA" amino acids 241 to 302 (62 residues), 51.3 bits, see alignment E=1.5e-17 PF02518: HATPase_c" amino acids 349 to 453 (105 residues), 97.7 bits, see alignment E=8.6e-32

Best Hits

Swiss-Prot: 100% identical to ZRAS_KLEOX: Sensor protein ZraS (zraS) from Klebsiella oxytoca

KEGG orthology group: K07709, two-component system, NtrC family, sensor histidine kinase HydH [EC: 2.7.13.3] (inferred from 74% identity to kpn:KPN_04385)

Predicted SEED Role

"Sensor protein of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW90 at UniProt or InterPro

Protein Sequence (462 amino acids)

>BWI76_RS01600 sensor protein ZraS (Klebsiella michiganensis M5al)
MNVMRLSKDSVAVGLSWLLTGLILLLVCLFSALIVRDYGRENEAARQTIQEKGSVLIRAL
ESGTRVGMGMRMHHSQLQTLLEEMAWQPGVLWFAVTDENGKIIAHSDPRRVGESLYPAST
LRELNIGSEERWRRLEQPEPALEIYRQFRPLNGGGHHMRMMMRRESADLRNQAPQVIFIA
FDTRELDADHARGLRNMVIMLCAAGVVMAATVLAQFWFRRYQRSRKQLQEATARKEKLVA
LGHLAAGVAHEIRNPLSSIKGLAKYFAERTPADGEAHQLALVMAREADRLNRVVSELLEL
VRPAHLKYQSVDLNEVITHSLQLVSQDAASRAISLTFTAQPALCRIQADPDRLKQVLLNL
YLNAVHAIGREGVITVAVRECGDGRVKVSVADSGKGMTAEQLQAIFTPYFSTKADGTGLG
LAVVQNIVEQHGGTIDAESAPGKGALFTFYLPVNGQQKDEQG