Protein Info for BWI76_RS01525 in Klebsiella michiganensis M5al

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 354 to 508 (155 residues), 112.7 bits, see alignment E=7.4e-37 PF00990: GGDEF" amino acids 356 to 506 (151 residues), 113 bits, see alignment E=6.4e-37

Best Hits

KEGG orthology group: None (inferred from 85% identity to kva:Kvar_4872)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW97 at UniProt or InterPro

Protein Sequence (510 amino acids)

>BWI76_RS01525 sensor domain-containing diguanylate cyclase (Klebsiella michiganensis M5al)
MARHNRKLSFTTPIVIGFAGILISFLLIAVFATMTQRKDFLEDYHHINRNFTHNMATNYT
ETLLRGNDFILTRATTFFARNDELNNAVNVNPEKGLMQLMQLQNMMQTVSSISLADTNGH
YLRAPEVLETEDSQSFDAKSRPWFIKQAQASTFSLYTSPYIDYFTHHPTITLYKPIISPE
GRLKGSLAFHLDLTSMGYALRQMVAPVQGEFFVVQRDGKVVLHPDPGALFKPYVSEALMD
RMTSGEGQLYDAVTDGWYYYYSFTNPDWFVIYRVDNSTLVNLTRHETDIVAWSFALAAIV
IVLFGLYLRHASRTVLMNIINAIKTGDVQRAPRLEAMLSKAIESNKQRELTYVRQATIDA
LTGCKNRRAFDSDIAALMNDHHPFSLALVDIDNFKTINDTWGHLNGDIVLRNVAREGLQI
LQPLQISLYRYGGEEFAVIFSDEHIDNALRLLESWRASVAQRSWREEGLTVTFSAGLGEW
NMEPLEQLVVRVDEALYKAKQQGKNRIVRT