Protein Info for BWI76_RS01510 in Klebsiella michiganensis M5al

Annotation: anaerobic C4-dicarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 89 to 117 (29 residues), see Phobius details amino acids 137 to 162 (26 residues), see Phobius details amino acids 171 to 195 (25 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 342 to 372 (31 residues), see Phobius details amino acids 376 to 393 (18 residues), see Phobius details amino acids 420 to 444 (25 residues), see Phobius details PF03605: DcuA_DcuB" amino acids 6 to 376 (371 residues), 480.7 bits, see alignment E=1.4e-148 TIGR00770: transporter, anaerobic C4-dicarboxylate uptake (Dcu) family" amino acids 6 to 443 (438 residues), 655.3 bits, see alignment E=2.4e-201

Best Hits

Swiss-Prot: 94% identical to DCUB_SHIFL: Anaerobic C4-dicarboxylate transporter DcuB (dcuB) from Shigella flexneri

KEGG orthology group: None (inferred from 99% identity to eae:EAE_08135)

MetaCyc: 94% identical to anaerobic C4-dicarboxylate transporter DcuB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-106; TRANS-RXN-106A; TRANS-RXN-106B; TRANS-RXN-299; TRANS-RXN0-499

Predicted SEED Role

"C4-dicarboxylate transporter DcuB"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW13 at UniProt or InterPro

Protein Sequence (446 amino acids)

>BWI76_RS01510 anaerobic C4-dicarboxylate transporter (Klebsiella michiganensis M5al)
MEFAIQLIIILICLFYGAKKGGIALGLLGGIGLVILVFVFHLKPGKPPVDVMLVIIAVVA
ASATLQASGGLDVMLQIAEKLLRRNPKYVSIVAPFVTCTLTILCGTGHVVYTILPIIYDV
AIKNNIRPERPMAASSIGAQMGIIASPVSVAVVSLVAMLGNFTFNGKHLEFLDLLAITIP
STLLGILAIGIFSWFRGKDLDKDPEFQAFIAVPENRHYVYGDTATLLDKKLPTSNWIAMW
IFLASIAVVALLGAFSELRPVVDGKALSMVLVIQMFMLLSGALIIIITKTNPASISKNEV
FRSGMIAIVAVYGIAWMAETMFGAHMTEIKGVLGEMVKEYPWAYAIVLLLVSKFVNSQAA
ALAAIVPVALAIGVDPAYIVASAPACYGYYILPTYPSDLAAIQFDRSGTTHIGRFVINHS
FILPGLIGVSVSCVFGWVFAAMYGFL