Protein Info for BWI76_RS01495 in Klebsiella michiganensis M5al

Annotation: 50S ribosomal protein L7/L12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00855: ribosomal protein bL12
  • amino acids 1 to 121 (121 residues), 161.8 bits, E=4.9e-52
• PF16320: Ribosomal_L12_N
  • amino acids 4 to 50 (47 residues), 62.3 bits, E=2.8e-21
• PF00542: Ribosomal_L12
  • amino acids 55 to 121 (67 residues), 107.9 bits, E=2.6e-35

Best Hits

Swiss-Prot: 98% identical to RL7_ENT38: 50S ribosomal protein L7/L12 (rplL) from Enterobacter sp. (strain 638)

KEGG orthology group: K02935, large subunit ribosomal protein L7/L12 (inferred from 97% identity to ecf:ECH74115_5451)

MetaCyc: 97% identical to 50S ribosomal subunit protein L12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L7/L12 (P1/P2)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See A0A285AW52 at UniProt or InterPro

Protein Sequence (121 amino acids)

>BWI76_RS01495 50S ribosomal protein L7/L12 (Klebsiella michiganensis M5al)
MSITKDQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILK
GIGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVEV
K