Protein Info for BWI76_RS01420 in Klebsiella michiganensis M5al

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 5 to 330 (326 residues), 387.8 bits, E=1.5e-120
• PF01565: FAD_binding_4
  • amino acids 18 to 148 (131 residues), 80 bits, E=1.4e-26
• PF02873: MurB_C
  • amino acids 206 to 329 (124 residues), 102.2 bits, E=1.6e-33

Best Hits

Swiss-Prot: 80% identical to MURB_ECOL6: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 86% identity to eae:EAE_08075)

MetaCyc: 79% identical to UDP-N-acetylenolpyruvoylglucosamine reductase (Escherichia coli K-12 substr. MG1655)
UDPNACETYLMURAMATEDEHYDROG-RXN [EC: 1.3.1.98]

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan recycling I (14/14 steps found)
• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158 or 1.3.1.98

Sequence Analysis Tools

See A0A285AW42 at UniProt or InterPro

Protein Sequence (342 amino acids)

>BWI76_RS01420 UDP-N-acetylenolpyruvoylglucosamine reductase (Klebsiella michiganensis M5al)
MSHSLKPWNTFGIDRSAKTIVRAETEKQLLDAWQNAAAQRQPILILGEGSNVLFLKDYAG
TVIINRIMGIEVSETPDAWHLHVGAGENWHQLVQFALNNGMPGLENLALIPGCTGSSPIQ
NIGAYGVELQKVCQYVDCVELATGEKLRLFAAECRFGYRDSIFKHEYQDRYAIVAVGLML
PKEWQPVLTYGDLTRLDPQTVTPRQVFDAVCHMRMTKLPDPKVNGNAGSFFKNPVVSADK
AQALLAAYPNIPHYPQPDGSMKLAAGWLIDQCQLKGKVMGGAAVHSQQALVLINHNQATS
EDVVELAHYVRQQVGEKFDIWLQPEVRFIGETGEVNAEETIA