Protein Info for BWI76_RS01390 in Klebsiella michiganensis M5al

Annotation: protoporphyrinogen oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF12724: Flavodoxin_5" amino acids 4 to 152 (149 residues), 182 bits, see alignment E=4e-58

Best Hits

Swiss-Prot: 75% identical to HEMG_ECOLI: Protoporphyrinogen IX dehydrogenase [menaquinone] (hemG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_08070)

MetaCyc: 75% identical to protoporphyrinogen oxidase (Escherichia coli K-12 substr. MG1655)
RXN-21483 [EC: 1.3.5.3]; 1.3.5.3 [EC: 1.3.5.3]

Predicted SEED Role

"Protoporphyrinogen IX oxidase, oxygen-independent, HemG (EC 1.3.-.-)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.-.- or 1.3.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW14 at UniProt or InterPro

Protein Sequence (177 amino acids)

>BWI76_RS01390 protoporphyrinogen oxidase (Klebsiella michiganensis M5al)
MKTLILFSTRDGQTREIASYLASELKEQGIDADTIDLNRTNEVEWPLYDRVVIGASIRYG
HFHPALERFVKTHLQSLQALPGAFFSVNLVARKPEKRTPQTNSYTRKFLLNSPWQPQHCA
VFAGALRYPRYRWYDRFMIRLIMKMTGGETDVSKEVVYTDWQQVGRFAREIAQMTSK