Protein Info for BWI76_RS01330 in Klebsiella michiganensis M5al

Annotation: twin-arginine translocase subunit TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 111 to 137 (27 residues), see Phobius details amino acids 157 to 183 (27 residues), see Phobius details amino acids 195 to 212 (18 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 9 to 226 (218 residues), 262.5 bits, see alignment E=1.7e-82 PF00902: TatC" amino acids 12 to 221 (210 residues), 247.9 bits, see alignment E=4.4e-78

Best Hits

Swiss-Prot: 84% identical to TATC_ECO57: Sec-independent protein translocase protein TatC (tatC) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 95% identity to eae:EAE_08020)

MetaCyc: 84% identical to twin arginine protein translocation system - TatC protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW00 at UniProt or InterPro

Protein Sequence (257 amino acids)

>BWI76_RS01330 twin-arginine translocase subunit TatC (Klebsiella michiganensis M5al)
MGVDDTQPLITHLIELRKRLINSILAILVIFLALVYFANDIYQLVSAPLIRQMPVGATMI
ATDVASPFFTPIKLTFMVSIILSVPVILYQVWAFVAPALYKHERRLVMPLLVSSTLLFYI
GMAFAYFVVFPLAFGFLTHAAPEGVQVSTDIRSYLDFVMALFIAFGVSFEVPVAIVLLCW
MGVTTPDDLRKKRPYVLVGAFVVGMLLTPPDVFSQTLLAIPMYCLFEVGVFFARFYTGKR
LTRDEDAAAEEAQGKEE