Protein Info for BWI76_RS01305 in Klebsiella michiganensis M5al

Annotation: bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 15 to 250 (236 residues), 371.9 bits, E=4e-115
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 25 to 250 (226 residues), 293.4 bits, E=4.5e-92
• PF13489: Methyltransf_23
  • amino acids 50 to 233 (184 residues), 55.6 bits, E=1.8e-18
• PF01135: PCMT
  • amino acids 61 to 168 (108 residues), 26.6 bits, E=1.7e-09
• PF13847: Methyltransf_31
  • amino acids 63 to 228 (166 residues), 76.8 bits, E=5.5e-25
• PF13649: Methyltransf_25
  • amino acids 67 to 164 (98 residues), 82.8 bits, E=8.3e-27
• PF08242: Methyltransf_12
  • amino acids 68 to 166 (99 residues), 49.7 bits, E=1.9e-16
• PF08241: Methyltransf_11
  • amino acids 68 to 168 (101 residues), 80.6 bits, E=3.9e-26

Best Hits

Swiss-Prot: 98% identical to UBIE_KLEP7: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_07995)

MetaCyc: 93% identical to bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinol methylase and demethylmenaquinone methyltransferase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]; ADOMET-DMK-METHYLTRANSFER-RXN [EC: 2.1.1.201, 2.1.1.163]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• superpathway of menaquinol-10 biosynthesis (8/10 steps found)
• superpathway of menaquinol-11 biosynthesis (8/10 steps found)
• superpathway of menaquinol-12 biosynthesis (8/10 steps found)
• superpathway of menaquinol-13 biosynthesis (8/10 steps found)
• superpathway of menaquinol-6 biosynthesis (8/10 steps found)
• superpathway of menaquinol-7 biosynthesis (8/10 steps found)
• superpathway of menaquinol-9 biosynthesis (8/10 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-10 biosynthesis (1/2 steps found)
• menaquinol-11 biosynthesis (1/2 steps found)
• menaquinol-12 biosynthesis (1/2 steps found)
• menaquinol-13 biosynthesis (1/2 steps found)
• menaquinol-7 biosynthesis (1/2 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

See A0A285AW34 at UniProt or InterPro

Protein Sequence (251 amino acids)

>BWI76_RS01305 bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (Klebsiella michiganensis M5al)
MVEDSQETTHFGFQTVAKEQKADMVAHVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSG
VRRGQTVLDLAGGTGDLTAKFSRLVGETGRVMLADINDSMLKMGREKLRNIGIVGNVEYV
QANAEALPFADNTFDCITISFGLRNVTDKEKALRSMYRVLKPGGRLLVLEFSKPIIEPLS
KAYDAYSFHILPRVGELVAKDAESYRYLAESIRMHPDQETLKGMMQDAGFESVDYYNLTA
GIVALHRGYKF