Protein Info for BWI76_RS01300 in Klebsiella michiganensis M5al

Annotation: DNA recombination protein RmuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 343 to 357 (15 residues), see Phobius details PF02646: RmuC" amino acids 137 to 433 (297 residues), 369.5 bits, see alignment E=5.4e-115

Best Hits

Swiss-Prot: 87% identical to RMUC_SALTY: DNA recombination protein RmuC (rmuC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 93% identity to eae:EAE_07990)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW21 at UniProt or InterPro

Protein Sequence (482 amino acids)

>BWI76_RS01300 DNA recombination protein RmuC (Klebsiella michiganensis M5al)
MDISIIMSAVAALAVGLIVGWLATKAHADQIRADLIEERRELDIELSAARQQLVQESHWR
EECELLNNELRSLRDINASLEADLREVTTRLESTQLHAEDKIRQMVNSEQRLSEQFENLA
NRIFEHSNRRVDEQNRQSLHGLLTPLREQLDGFRRQVQDSFGQEARERHTLAHEIRNLQQ
LNAQMAQEALNLTRALKGDNKTQGNWGEVVLTRVLEASGLREGHEYQTQVSIETDNRSRM
QPDVIVRLPQGKDVVIDAKMTLVAYERYFNAEDDYTREAALQEHIASVRNHMRLLGRKDY
QQLPGLRSLDYVLMFIPVEPAFLLAIDRQPELISEALKNNIMLVSPTTLLVALRTIANLW
RYEHQSRNAQKIAERAGRLYDKMRLFVDDMSAIGQSLDKAQDNYRQAMKKLASGRGNLLV
QAESFRELGVEVKRGINPDLVEQATAQDEEYFLTDDGNVQEDKDFSSDTAAAAAYDNRPQ
PR