Protein Info for BWI76_RS01290 in Klebsiella michiganensis M5al

Annotation: putative dienelactone hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01738: DLH
  • amino acids 43 to 265 (223 residues), 240.3 bits, E=1.8e-75
• PF00326: Peptidase_S9
  • amino acids 190 to 266 (77 residues), 24.1 bits, E=2.3e-09

Best Hits

Swiss-Prot: 80% identical to DLHH_ECOLI: Putative carboxymethylenebutenolidase (ysgA) from Escherichia coli (strain K12)

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 89% identity to kpu:KP1_0188)

Predicted SEED Role

"Putative carboxymethylenebutenolidase (EC 3.1.1.45)" (EC 3.1.1.45)

MetaCyc Pathways

• 4-chlorocatechol degradation (3/5 steps found)
• 4,5-dichlorocatechol degradation (3/7 steps found)
• 3,4,6-trichlorocatechol degradation (4/9 steps found)
• 3-chlorocatechol degradation I (ortho) (1/5 steps found)
• 3-chlorocatechol degradation II (ortho) (1/5 steps found)
• 3,5-dichlorocatechol degradation (3/8 steps found)
• 1,4-dichlorobenzene degradation (3/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Fluorobenzoate degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.45

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

See A0A285AVZ1 at UniProt or InterPro

Protein Sequence (270 amino acids)

>BWI76_RS01290 putative dienelactone hydrolase (Klebsiella michiganensis M5al)
MTTIKQTGFAPAATPHAATAVHTSDENIVSGETSIPSQGDNMPAFHARPGNIDGPLPVVI
VVQEIFGVHEHIRDICRRLAKEGYLAIAPELYFRQGDPNDYSDIPSLFQGLVKKVPDSQV
LADLDHVASWASRHGGDAHRLLITGFCWGGRITWLYAAHNPQLKAAVAWYGKLVGEKTLN
SPKHPVDIAVDLNAPVLGLYGAKDDSIPQDTVETMRQALRAANATAEIVVYPQADHAFNA
DYRASYHEESAKDGWQRMLAWFAQHGGQRG