Protein Info for BWI76_RS01230 in Klebsiella michiganensis M5al

Annotation: chloramphenicol resistance permease RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 167 (17 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details PF00892: EamA" amino acids 8 to 142 (135 residues), 56.9 bits, see alignment E=1.3e-19 TIGR00688: protein RarD" amino acids 9 to 261 (253 residues), 362.7 bits, see alignment E=5.4e-113

Best Hits

Swiss-Prot: 95% identical to RARD_SALTY: Protein RarD (rarD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 92% identity to cko:CKO_00158)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVW9 at UniProt or InterPro

Protein Sequence (297 amino acids)

>BWI76_RS01230 chloramphenicol resistance permease RarD (Klebsiella michiganensis M5al)
MDAKQTRVGVLLALAAYFIWGIAPAYFKLIYYVPADEILTHRVIWSFFFMVALISVSRQW
PQVKRLLKTPKKVLLLALSAVLVGGNWLLFIWAVNNHHMLEASLGYFINPLVNILLGMIF
LGERFRRMQWLAVLLAACGVLVQLWTFGSLPIIALGLAFSFAFYGLLRKKIAVDAQTGML
FETLWLLPVAAIYLFGIADSPTSHMGQNPWSLNLLLMAAGVVTTIPLLCFTGAATRLRLS
TLGFFQYIGPTLMFLLAVTFYGEVPGADKMVTFAFIWVALAIFVMDAIYTIRRTRRA