Protein Info for BWI76_RS01220 in Klebsiella michiganensis M5al

Annotation: DNA-dependent helicase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 TIGR01075: DNA helicase II" amino acids 6 to 718 (713 residues), 1400 bits, see alignment E=0 PF00580: UvrD-helicase" amino acids 10 to 272 (263 residues), 313.6 bits, see alignment E=4.5e-97 PF13245: AAA_19" amino acids 14 to 255 (242 residues), 81.2 bits, see alignment E=2.5e-26 PF13361: UvrD_C" amino acids 277 to 616 (340 residues), 282.5 bits, see alignment E=2e-87 PF13538: UvrD_C_2" amino acids 556 to 612 (57 residues), 30 bits, see alignment 1.2e-10 PF21196: PcrA_UvrD_tudor" amino acids 673 to 715 (43 residues), 51.8 bits, see alignment 1.7e-17

Best Hits

Swiss-Prot: 97% identical to UVRD_ECOLI: DNA helicase II (uvrD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eae:EAE_07910)

MetaCyc: 97% identical to DNA helicase II (Escherichia coli K-12 substr. MG1655)
RXN-11135 [EC: 5.6.2.4]

Predicted SEED Role

"ATP-dependent DNA helicase UvrD/PcrA" in subsystem DNA repair, bacterial UvrD and related helicases

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.6.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVW2 at UniProt or InterPro

Protein Sequence (720 amino acids)

>BWI76_RS01220 DNA-dependent helicase II (Klebsiella michiganensis M5al)
MDVSYLLDSLNDKQREAVAASRTNMLVLAGAGSGKTRVLVHRIAWLLSVENCSPYSIMAV
TFTNKAAAEMRHRIGQLMGTTQGGMWVGTFHGLAHRLLRAHHLDANLPQDFQILDSEDQL
RLLKRLIKAMNLDEKQWPPRQAMWYINGQKDEGLRPHHIQSYGNPVEQTWQKVYQAYQEA
CDRAGLVDFAELLLRAHELWLNKPHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGDT
GKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPGAETIRLEQNYRSTSNILSAANALIENN
SGRLGKKLWTDGADGEPISLYCAFNDLDEARFVVNRIKTWQENGGALEQCAILYRSNAQS
RVLEEALLQASMPYRIYGGMRFFERQEIKDALSYLRLIANRNDDAAFERVVNTPTRGIGD
RTLDVVRQTSRDRQLTLWQACRELLKDKVLAGRAASALQRFMELIDALAQETADMPLHVQ
TDRVIKDSGLRMMYEQEKGEKGQTRIENLEELVTATRQFSYNEEDEDLMPLQAFLSHAAL
EAGEGQADTWQDAVQLMTLHSAKGLEFPQVFIVGVEEGMFPSQMALDEGGRLEEERRLAY
VGVTRAMQKLTLTYAETRRLYGKEVYHRPSRFIGELPESCVEEVRLRATVSRPVSHQRMG
TPMAENDTGYKLGQRVRHAKFGEGTIVNLEGSGEHSRLQVAFQGQGIKWLVAAYARLETV