Protein Info for BWI76_RS01165 in Klebsiella michiganensis M5al

Annotation: protoheme IX biogenesis protein HemY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details TIGR00540: heme biosynthesis-associated TPR protein" amino acids 4 to 386 (383 residues), 383.8 bits, see alignment E=3.9e-119 PF07219: HemY_N" amino acids 26 to 132 (107 residues), 120.6 bits, see alignment E=6.3e-39 PF07719: TPR_2" amino acids 329 to 360 (32 residues), 25.1 bits, see alignment (E = 2.6e-09)

Best Hits

Swiss-Prot: 90% identical to HEMY_ECOLI: Protein HemY (hemY) from Escherichia coli (strain K12)

KEGG orthology group: K02498, HemY protein (inferred from 94% identity to kpu:KP1_0160)

Predicted SEED Role

"Uncharacterized protein EC-HemY, likely associated with heme metabolism based on gene clustering with hemC, hemD in Proteobacteria (unrelated to HemY-type PPO in GramPositives)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW05 at UniProt or InterPro

Protein Sequence (398 amino acids)

>BWI76_RS01165 protoheme IX biogenesis protein HemY (Klebsiella michiganensis M5al)
MLKILLLFALLLAGIVVGPMIAGHQGYVLIQTDNYNIETSVTGLAIIMILTMVVLFAIEW
LLRRIFRTGAHTRGWFVGRKRRRARKQTEQALLKLAEGDYQQVEKLMAKNADHAEQPVVN
YLLAAEAAQQRGDEARANQHLERATELAGDDLIPVEITRVRLQLARNENHAARHGIDKLL
EITPRHPEVLRLAEQAYIRTGAWNSLLDIIPSMAKADVSDEEHRAELEQLAWIGLMDKTL
ADGGSEGLRGWWKNQNRKTRSQVALQVAMANRLIESDDHDTAQQIIIDGLKKHYDDRLVM
PIPRLKTNNPEQLEKVLRQQIKTVGDRPLLWSTLGQSLMRHGEWQEASIAFRAALKQRPD
AFDYAWLADTLDRLHQPEEAATMRRDGLLLTLQNNPQQ