Protein Info for BWI76_RS01140 in Klebsiella michiganensis M5al

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 93 to 119 (27 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 273 to 299 (27 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details amino acids 429 to 448 (20 residues), see Phobius details PF00324: AA_permease" amino acids 16 to 442 (427 residues), 367.8 bits, see alignment E=8.1e-114 PF13520: AA_permease_2" amino acids 20 to 437 (418 residues), 132.6 bits, see alignment E=2e-42

Best Hits

Swiss-Prot: 94% identical to YIFK_SALTY: Probable transport protein YifK (yifK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 96% identity to kpe:KPK_5383)

MetaCyc: 92% identical to threonine/serine:H+ symporter ThrP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71; TRANS-RXN-72

Predicted SEED Role

"Probable transport protein YifK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVZ3 at UniProt or InterPro

Protein Sequence (461 amino acids)

>BWI76_RS01140 amino acid permease (Klebsiella michiganensis M5al)
MTEKKAELQRGLEARHIELIALGGTIGVGLFMGAASTLKWAGPSVLLAYIIAGLFVFFIM
RSMGEMLFLEPVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMAVGISEITAIGVYVQFWFP
EMAQWIPALIAVGLVALANLAAVRLYGEIEFWFAMIKVTTIIVMIVVGLGVIFFGFGNGG
HAIGFGNLTEHGGFFAGGWKGFLTALCIVVASYQGVELIGITAGEAKNPQVTLRSAVGKV
LWRILIFYVGAIFVIVTIFPWDQIGSNGSPFVLTFAKIGITAAAGIINFVVLTAALSGCN
SGMYSCGRMLYALARNRQLPAAIAKVSRNGVPSAGVALSILILLVGSCLNYIIPNPQRVF
VYVYSASVLPGMVPWFVILISQLRFRLVHKEAMASHPFRSLLFPWANYLTMAFLVCVLIG
MGFNDDTRMSLFVGIIFLAAVTLIYKVFGLGRRGNVDNVAQ