Protein Info for BWI76_RS01130 in Klebsiella michiganensis M5al

Annotation: enterobacterial common antigen polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 24 (2 residues), see Phobius details amino acids 33 to 59 (27 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 336 to 361 (26 residues), see Phobius details amino acids 380 to 398 (19 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details PF06899: WzyE" amino acids 1 to 442 (442 residues), 848.4 bits, see alignment E=6.9e-260

Best Hits

Swiss-Prot: 87% identical to WZYE_CITK8: Probable ECA polymerase (wzyE) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_07835)

Predicted SEED Role

"Putative ECA polymerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVW5 at UniProt or InterPro

Protein Sequence (448 amino acids)

>BWI76_RS01130 enterobacterial common antigen polymerase (Klebsiella michiganensis M5al)
MTLMQFSGLLLVWLLSTLFIATATYFEFRRVRFNFNVFFSLLFLLTFFFGFPLTSILVFR
FDVAVAPPEILLQTLLVSVCFYAVYYATYKTRLRSATRGHSHRPLFTMNRVETHLTWGIL
LGLALLCVGIFFAHNGFLLFKLNSYSQIFSSEVSGVALKRFFYFFIPAMLVVYFLRQDYK
AWIFFLVSTVAFGLLTYAIVGGTRANIIIAFAIFLFIGIIRGWISLWMLAAAGVLGIVGM
FWLALKRYGMNVSGDEAFYTFLYLTRDTFSPWENLALLLQNYDKIEFQGLAPIVRDFYVF
IPSWLWHGRPTMVLNTANYFTWDVLNNHSGLAISPTLIGSLVVMGGVWFVPLGAVAVGLI
IKWFDWLYELGNRETNRYKAAILHSFCFGAIFNMIVLAREGLDSFGSRVVFFLVIFGICL
LAAKLLYWFLDSVGLIHKRAKPLTQPQV