Protein Info for BWI76_RS01050 in Klebsiella michiganensis M5al

Annotation: o-pyrocatechuate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 93% identity to eae:EAE_07765)

Predicted SEED Role

"2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (EC 4.1.1.45)" (EC 4.1.1.45)

MetaCyc Pathways

2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (1/4 steps found)
2-amino-3-carboxymuconate semialdehyde degradation to glutaryl-CoA (1/5 steps found)
2-nitrobenzoate degradation I (1/7 steps found)
L-tryptophan degradation IX (4/12 steps found)
L-tryptophan degradation XII (Geobacillus) (4/12 steps found)
L-tryptophan degradation III (eukaryotic) (4/15 steps found)
L-tryptophan degradation XI (mammalian, via kynurenine) (4/23 steps found)

KEGG Metabolic Maps

Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVT3 at UniProt or InterPro

Protein Sequence (332 amino acids)

>BWI76_RS01050 o-pyrocatechuate decarboxylase (Klebsiella michiganensis M5al)
MRGKIALEEHVSTPKNNSLWDATGEASRNGSEYMQDVERRLLDRSYQLNEMAQRNIDHVI
LSLTSPGAQSILDKATAVSFARETNDYIIENYVKPNPDKFSAFATLALQNPEAAAEELDR
AVKKLGMKGALINGYTNVQDSEHGLYLDDESMLVFWDKVNELNVPVYLHPREPLEGAARG
IYTGYESLIGSAWGFAQETAVHAIRLMMSGLFDRYPNLNLVLGHLGEGLVHMLPRTQHRL
YRQRFGCGLGKAEKPLMHYLQNNFIVTTSGHFNTYSLQNALDIMGPDRVMFSVDYPYEDI
HQACDWFDPLEMDTELKDKIAWGNASRVFNIK