Protein Info for BWI76_RS01015 in Klebsiella michiganensis M5al

Annotation: nicotinamide riboside transporter PnuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 109 to 138 (30 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 185 to 202 (18 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 22 to 230 (209 residues), 200.3 bits, see alignment E=1.4e-63 PF04973: NMN_transporter" amino acids 23 to 227 (205 residues), 180.6 bits, see alignment E=1.5e-57

Best Hits

Swiss-Prot: 69% identical to PNUC_SALTY: Nicotinamide riboside transporter PnuC (pnuC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03811, nicotinamide mononucleotide transporter (inferred from 91% identity to sty:STY3643)

MetaCyc: 69% identical to nicotinamide riboside transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-481

Predicted SEED Role

"Ribosyl nicotinamide transporter, PnuC-like" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVW7 at UniProt or InterPro

Protein Sequence (240 amino acids)

>BWI76_RS01015 nicotinamide riboside transporter PnuC (Klebsiella michiganensis M5al)
MDFFSINNVMVNIPLGEGGYALSWIEAIGTIFGLLCIWCASREKIINYLFGLINVTLFAA
IFFQIQLYASLLLQVFFFAANIYGWYAWSRQNEAQEAALKVRWLSRQQTLALGGVCAVAI
VLMTLFIDPVFATLTRIMIALLQTFGMQVAMPDLQPDAFPFWDSTMLVLSIAAMVLMTRK
FVENWLLWVLIDVISVVIYAVQGVYAMSLEYVLLTAIAVMGSYSWIKSAQRNGYTPLATS