Protein Info for BWI76_RS01005 in Klebsiella michiganensis M5al

Annotation: CarD family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00027: cNMP_binding" amino acids 44 to 126 (83 residues), 62.5 bits, see alignment E=2.9e-21 PF13545: HTH_Crp_2" amino acids 163 to 229 (67 residues), 36.6 bits, see alignment E=3.7e-13

Best Hits

KEGG orthology group: None (inferred from 82% identity to sea:SeAg_B4136)

Predicted SEED Role

"Predicted N-ribosylNicotinamide CRP-like regulator" in subsystem NAD and NADP cofactor biosynthesis global or PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVT4 at UniProt or InterPro

Protein Sequence (234 amino acids)

>BWI76_RS01005 CarD family transcriptional regulator (Klebsiella michiganensis M5al)
MDTMKKPDFSVSWLSGLSEIVSDPLLYELLKYCPLEIMRRWRFEEIPRGDFICRQGDVCQ
RFSLIIAGEVDVFYEAEDGRRYRQARYRKGDMLGELEIFESRHYICSVVAVGHVQLLSLS
QEHFCRWLALDNHFNQRMLRFFSQQYYQLSKKASSDNLYSLHQRVCQALWLRYQKDGASE
ILLDKQNLSQEFAATTRSINRILHDLKALQIIDTDGERIVLLAPEKLKQEADIG