Protein Info for BWI76_RS01000 in Klebsiella michiganensis M5al

Annotation: peptidyl-prolyl cis-trans isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13616: Rotamase_3
  • amino acids 14 to 91 (78 residues), 77.7 bits, E=1.1e-25
• PF00639: Rotamase
  • amino acids 15 to 89 (75 residues), 65.6 bits, E=6.5e-22

Best Hits

Swiss-Prot: 68% identical to PPIC_ECO57: Peptidyl-prolyl cis-trans isomerase C (ppiC) from Escherichia coli O157:H7

KEGG orthology group: K03769, peptidyl-prolyl cis-trans isomerase C [EC: 5.2.1.8] (inferred from 92% identity to kpe:KPK_5405)

MetaCyc: 68% identical to peptidyl-prolyl cis-trans isomerase C (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

See A0A285AVS6 at UniProt or InterPro

Protein Sequence (93 amino acids)

>BWI76_RS01000 peptidyl-prolyl cis-trans isomerase (Klebsiella michiganensis M5al)
MAKSAAALHILVKEEKLAQEILAKLERGVSFDHLAKRYSKCPSGRNGGDLGEFNQGVMVG
PFDKAVFSCPLLKPYGPVKTKFGYHIIKVLYRR