Protein Info for BWI76_RS00980 in Klebsiella michiganensis M5al

Annotation: PLP-dependent threonine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01124: threonine ammonia-lyase, biosynthetic
  • amino acids 15 to 512 (498 residues), 886 bits, E=3.3e-271
• PF00291: PALP
  • amino acids 30 to 316 (287 residues), 267 bits, E=2.3e-83
• PF00585: Thr_dehydrat_C
  • amino acids 329 to 419 (91 residues), 94.2 bits, E=3.4e-31
  • amino acids 425 to 512 (88 residues), 98.7 bits, E=1.4e-32

Best Hits

Swiss-Prot: 96% identical to ILVA_ECOLI: L-threonine dehydratase biosynthetic IlvA (ilvA) from Escherichia coli (strain K12)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 96% identity to ecg:E2348C_4074)

MetaCyc: 96% identical to threonine deaminase (Escherichia coli K-12 substr. MG1655)
Threonine ammonia-lyase. [EC: 4.3.1.19]

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

• superpathway of L-threonine metabolism (18/18 steps found)
• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• L-methionine degradation II (2/3 steps found)
• L-threonine degradation V (1/2 steps found)
• hypoglycin biosynthesis (4/14 steps found)
• cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

See A0A285AVT1 at UniProt or InterPro

Protein Sequence (514 amino acids)

>BWI76_RS00980 PLP-dependent threonine dehydratase (Klebsiella michiganensis M5al)
MAESQPLSAAPEGAEYLRAVLRAPVYEAAQITPLQKMEKLSSRLDNVVLVKREDRQPVHS
FKLRGAYAMMAGLTEEQKSHGVITASAGNHAQGVAFSASRLGVKALIVMPTATADIKVDA
VRGFGGEVLLHGANFDEAKAKAIELAQQQGFTWVPPFDHPMVIAGQGTLALELLQQDAHI
DRVFVPVGGGGLAAGVAVLIKQLMPQIKVIAVEAEDSACLKAALDAGHPVDLPRVGLFAE
GVAVKRIGDETFRLCQEYLDDIVTVDSDAICAAMKDLFEDVRAVAEPSGALALAGMKKYI
AQHNIRGERLAHVLSGANVNFHGLRYVSERCELGEQREALLAVTIPEEKGSFLKFCQLLG
GRSVTEFNYRFADAKNACIFVGVRLSRGLEERKEILNLLHEGGYSVVDLSDDEMAKLHVR
YMVGGRPSQPLQERLFSFEFPESPGALLKFLHTLGTHWNISLFHYRSHGTDYGRVLAAFE
LGDHEPDFETRLHELGYDCHDESNNPAFRFFLAG