Protein Info for BWI76_RS00890 in Klebsiella michiganensis M5al

Annotation: vitamin B12/cobalamin outer membrane transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01779: TonB-dependent vitamin B12 receptor" amino acids 2 to 622 (621 residues), 687.2 bits, see alignment E=1.1e-210 PF07715: Plug" amino acids 40 to 146 (107 residues), 103.6 bits, see alignment E=8.4e-34 PF00593: TonB_dep_Rec_b-barrel" amino acids 198 to 596 (399 residues), 154.8 bits, see alignment E=7.2e-49

Best Hits

Swiss-Prot: 54% identical to BTUB_SALCH: Vitamin B12 transporter BtuB (btuB) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 93% identity to cko:CKO_03025)

Predicted SEED Role

"Outer membrane vitamin B12 receptor BtuB" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVV9 at UniProt or InterPro

Protein Sequence (622 amino acids)

>BWI76_RS00890 vitamin B12/cobalamin outer membrane transporter (Klebsiella michiganensis M5al)
MIKKASLMTALSVTAFSGWAQDSNSDTLVVTANRFQQPVNTVLAPTDVVTREDIERWQAK
DLNDVMRRLPGVDVAQNGGMGQSSSLFIRGTEAKQVLVLVDGVPMVRPGITNNPDLNQIP
LSLVQRVEYIRGPRSAIYGSGAMGGVINVITHSDKEQSKITAGVGSKGYQQYDGTLRHRF
GDTVATVAGSYEGNKGFNVQPGSTWEHDGDRDGFRNKTFWGSLEHKFNENFDGFFRGHSY
TNNSDYDLGSPPYSPAYSADENQLYNQSWDAGLNFNSGIYSSQLIASYQKVKDYNYSSIY
GRYNDGTTLDRMTQHNLQWGNNVIVGHGSVSAGVDWQQQRLTSSDTTMSDTYKRDNTGLY
LTGQQQFGDVTLEASGREDHDEQFGWHGTWQTTAGWEFVENYRLTLGYGTGFLAPSLGQQ
FGSTRFGINANPNLKPEESKQWEAGLEGLTGPVDWRLSAYHYKITNLITYYSDPVTYEGE
YDNINAATIKGVEWTGSVDTGIFSHRVTLQYVDPRNDDNGEVLARRSKRQAKYQLDWSVF
DVDMDVSWQYYGKRYDNNTSQYNNTQRILPSYSTVDVSASYPITDRLTVRGKIANLFDKD
YETAYGYQTAGREYYLSGSYTF