Protein Info for BWI76_RS00855 in Klebsiella michiganensis M5al

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 3 to 456 (454 residues), 710.9 bits, E=4e-218
• PF00206: Lyase_1
  • amino acids 6 to 301 (296 residues), 343.6 bits, E=1.2e-106
• PF14698: ASL_C2
  • amino acids 364 to 431 (68 residues), 98.2 bits, E=3.1e-32

Best Hits

Swiss-Prot: 96% identical to ARLY_KLEP3: Argininosuccinate lyase (argH) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_07655)

MetaCyc: 96% identical to argininosuccinate lyase (Escherichia coli K-12 substr. MG1655)
Argininosuccinate lyase. [EC: 4.3.2.1]

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

See A0A285AVR2 at UniProt or InterPro

Protein Sequence (457 amino acids)

>BWI76_RS00855 argininosuccinate lyase (Klebsiella michiganensis M5al)
MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQQQLEE
ALNILLEDVRANPQQILESDAEDIHSWVEGKLIDKVGQLGKKLHTGRSRNDQVATDLKLW
CKDTVVELLSANRQLQSALVETAENNQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLARDE
SRLQDALKRLDVSPLGCGALAGTAYEIDREQLAGWLGFASATRNSLDSVSDRDHVLELLS
DASIGMVHLSRFAEDLIFFNTGEAGFVELSDRVTSGSSLMPQKKNPDALELIRGKCGRVQ
GALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLHMAALVLDGIQVKRPRCEEAA
QQGYANATELADYLVAKGVPFREAHHIVGEAVVEAIAQGKPLEDLPLADLQKFSRVIAED
VYPILSLQSCLDKRAAKGGVSPQQVAQAIADAKQRLV