Protein Info for BWI76_RS00840 in Klebsiella michiganensis M5al

Annotation: acetylornithine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR01892: acetylornithine deacetylase (ArgE)" amino acids 10 to 377 (368 residues), 555.3 bits, see alignment E=3.2e-171 PF04389: Peptidase_M28" amino acids 72 to 157 (86 residues), 22 bits, see alignment E=1.9e-08 PF01546: Peptidase_M20" amino acids 76 to 377 (302 residues), 113.7 bits, see alignment E=1.7e-36 PF07687: M20_dimer" amino acids 178 to 287 (110 residues), 85.2 bits, see alignment E=4.5e-28

Best Hits

Swiss-Prot: 97% identical to ARGE_KLEP3: Acetylornithine deacetylase (argE) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 96% identity to kpn:KPN_04246)

MetaCyc: 92% identical to acetylornithine deacetylase (Escherichia coli K-12 substr. MG1655)
Acetylornithine deacetylase. [EC: 3.5.1.16]

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.16

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVT6 at UniProt or InterPro

Protein Sequence (383 amino acids)

>BWI76_RS00840 acetylornithine deacetylase (Klebsiella michiganensis M5al)
MKNKLPPFIEIYRALIATPSISATEEALDQSNESLINLLAGWFRDIGFNVEVQPVPDTRN
KFNLLASSGHGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDNKLYGLGTADMKGFFAFI
LDALRDVDVTQLKKPLYILATADEETSMAGARYFAETTQLRPDCAIIGEPTSLQPIRAHK
GHMSNAVRIQGQSGHSSDPARGVNAIELMHDAIGRIMQLRDDLKERYHYAAFTVPWPTLN
LGAIHGGDASNRICACCELHMDIRPLPGMTLNDLNGLLNEALAPVSERWPGRLTVSELHP
PIPGYECPPDHKLVEVVEKLLGAQTDVVNYCTEAPFIQTLCPTLVLGPGSINQAHQPDEY
LETRFIKPTRELITQVVHHFCWH