Protein Info for BWI76_RS00805 in Klebsiella michiganensis M5al

Annotation: 5,10-methylenetetrahydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF02219: MTHFR" amino acids 16 to 291 (276 residues), 369.2 bits, see alignment E=7.5e-115 TIGR00676: methylenetetrahydrofolate reductase [NAD(P)H]" amino acids 25 to 290 (266 residues), 355.6 bits, see alignment E=8.7e-111

Best Hits

Swiss-Prot: 95% identical to METF_SALTY: 5,10-methylenetetrahydrofolate reductase (metF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00297, methylenetetrahydrofolate reductase (NADPH) [EC: 1.5.1.20] (inferred from 96% identity to kpu:KP1_0102)

MetaCyc: 95% identical to 5,10-methylenetetrahydrofolate reductase (Escherichia coli K-12 substr. MG1655)
RXN-22438 [EC: 1.5.1.54]

Predicted SEED Role

"5,10-methylenetetrahydrofolate reductase (EC 1.5.1.20)" in subsystem Methionine Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 1.5.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.20 or 1.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVQ0 at UniProt or InterPro

Protein Sequence (295 amino acids)

>BWI76_RS00805 5,10-methylenetetrahydrofolate reductase (Klebsiella michiganensis M5al)
MSFFHANQREALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWKSIDRLSSLKPKFVSVTY
GANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDASRDELRTIAKDYWDSGIRHIVALRGD
LPPGSGKPDMYAVDLVTLLKEVGDFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRA
ITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPTWMAKMFE
GLDNDAETRQLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPA