Protein Info for BWI76_RS00760 in Klebsiella michiganensis M5al

Annotation: cell division protein FtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 32 to 57 (26 residues), see Phobius details TIGR02223: cell division protein FtsN" amino acids 1 to 320 (320 residues), 307.3 bits, see alignment E=6.9e-96 PF05036: SPOR" amino acids 251 to 318 (68 residues), 59.6 bits, see alignment E=1.6e-20

Best Hits

Swiss-Prot: 77% identical to FTSN_ECOLI: Cell division protein FtsN (ftsN) from Escherichia coli (strain K12)

KEGG orthology group: K03591, cell division protein FtsN (inferred from 89% identity to kpu:KP1_0090)

MetaCyc: 77% identical to cell division protein FtsN (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cell division protein FtsN" in subsystem Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVN4 at UniProt or InterPro

Protein Sequence (324 amino acids)

>BWI76_RS00760 cell division protein FtsN (Klebsiella michiganensis M5al)
MAQRDYVRRSQPASSRRKKSNTRSSRNKQGGLSAVSPTMVAIAAAVLVAFIGGLYFITHH
KKEEAEALQNRQAAGNGLPPKPEERWRYIKELESRQPGVRAPTEPTAGGEVMKPEQLTDE
QRQLLAQMQADMRQQPTQLTEVPWNEQTPAQRQQTLQRQRLAQQQVQQQQLAQAQQQTQV
QQPRTQPRVVEQSKPVQQQPRQTASNQQPYQDLLQTPAHTSTAQPKAQAAAPVTRVEEAP
KTAATEKKDDRSWMIQCGSFKGAEQAETVRAQLAFEGFASHITTNNGWNRVVIGPLKGKE
NASNMIERLKMAGHANCIRLAARG