Protein Info for BWI76_RS00750 in Klebsiella michiganensis M5al

Annotation: ATP-dependent protease ATP-binding subunit HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 4 to 444 (441 residues), 770.4 bits, see alignment E=2.9e-236 PF07728: AAA_5" amino acids 52 to 88 (37 residues), 25.1 bits, see alignment 4e-09 PF00004: AAA" amino acids 53 to 135 (83 residues), 32.1 bits, see alignment E=3.8e-11 amino acids 241 to 333 (93 residues), 28.1 bits, see alignment E=6.4e-10 PF07724: AAA_2" amino acids 187 to 330 (144 residues), 99.2 bits, see alignment E=6.6e-32

Best Hits

Swiss-Prot: 98% identical to HSLU_KLEP3: ATP-dependent protease ATPase subunit HslU (hslU) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 98% identity to kpn:KPN_04226)

MetaCyc: 93% identical to ATPase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVN8 at UniProt or InterPro

Protein Sequence (444 amino acids)

>BWI76_RS00750 ATP-dependent protease ATP-binding subunit HslU (Klebsiella michiganensis M5al)
MSEMTPREIVSELDKHIIGQDAAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTG
VGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAIKMVRMQSIDKNR
YRAEELAEERILDVLIPPAKNNWGQAEQPQEPSAARQSFRKKLREGQLDDKEIEIDLAAA
PMGVEIMSPPGMEEMTSQLQSMFQNLGGQKQKPRKLKIKDAMKLLIEEEAAKLVNPEELK
QDAIDAVEQHGIVFIDEIDKICKRGGNSSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKT
DHILFIASGAFQVASPSDLIPELQGRLPIRVELKALTTHDFERILTEPNASITVQYKALM
ATEGVNIEFTEEGIKRIAQAAWQVNETTENIGARRLHTVLERLIEDISYDASEMNGQTVT
IDAEYVGKHLDVLVADEDLSRFIL