Protein Info for BWI76_RS00745 in Klebsiella michiganensis M5al

Annotation: 1,4-dihydroxy-2-naphthoate polyprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 290 to 307 (18 residues), see Phobius details TIGR00751: 1,4-dihydroxy-2-naphthoate octaprenyltransferase" amino acids 17 to 300 (284 residues), 465.4 bits, see alignment E=3.6e-144 PF01040: UbiA" amino acids 27 to 278 (252 residues), 112.8 bits, see alignment E=8.7e-37

Best Hits

Swiss-Prot: 83% identical to MENA_ECOLI: 1,4-dihydroxy-2-naphthoate octaprenyltransferase (menA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 88% identity to eae:EAE_07555)

MetaCyc: 83% identical to 1,4-dihydroxy-2-naphthoate octaprenyltransferase (Escherichia coli K-12 substr. MG1655)
DMK-RXN [EC: 2.5.1.74]

Predicted SEED Role

"1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74)" (EC 2.5.1.74)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVT8 at UniProt or InterPro

Protein Sequence (308 amino acids)

>BWI76_RS00745 1,4-dihydroxy-2-naphthoate polyprenyltransferase (Klebsiella michiganensis M5al)
MTEHAITRTQAWLESLRPKTLPLAFAAIIVGSALAWHQGSFDPWVALLAIITAGLLQILS
NLANDYGDAIKGSDKPDRIGPLRGMQKGAITQAQMKRALILTVALICLSGLALLFLSWQT
MADFIGFMVLGGLAIVAAITYTVGTRPYGYIGLGDISVLVFFGWLSVVGSWYLQAHSVEA
VIFLPATACGLLATAVLNINNLRDIDSDRENGKNTLAVRLGPVNARRYHACLLFGALLCL
ALFNLISLHNPWGWLFLLATPLLVKQARYVIRERDPVAMRPMLERTVKGALLTNLLFVIG
IIFSRLAA