Protein Info for BWI76_RS00730 in Klebsiella michiganensis M5al

Annotation: cation-efflux pump FieF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 158 to 175 (18 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 10 to 288 (279 residues), 258.3 bits, see alignment E=4.2e-81 PF01545: Cation_efflux" amino acids 14 to 206 (193 residues), 173.6 bits, see alignment E=4.6e-55 PF16916: ZT_dimer" amino acids 210 to 287 (78 residues), 89.3 bits, see alignment E=1.4e-29

Best Hits

Swiss-Prot: 93% identical to FIEF_KLEPN: Cation-efflux pump FieF (fieF) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 93% identity to eae:EAE_07540)

MetaCyc: 88% identical to Zn2+/Fe2+/Cd2+ exporter (Escherichia coli K-12 substr. MG1655)
RXN0-6; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVP2 at UniProt or InterPro

Protein Sequence (298 amino acids)

>BWI76_RS00730 cation-efflux pump FieF (Klebsiella michiganensis M5al)
MSQSYGQLVSRAAIAATVMASALLLIKIFAWWYTGSVSILAALVDSLVDIAASLTNLLVV
RYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGIQHLVRPEPMNAAGVGMVV
TLVALVSTLLLVTFQRWVVRKTQSQAVRADMLHYQSDVMMNGAILVALALSWYGWHRADA
LFALGIGVYILYSALRMAYDAVQSLLDRALPDEERQDIINIVTAWPGVSGAHDLRTRQSG
PTRFIQIHLEMEDNLPLVQAHVIADQVEQALLLRFPGSDVIIHQDPCSVVPLGRQGVL