Protein Info for BWI76_RS00700 in Klebsiella michiganensis M5al

Annotation: rhamnose/proton symporter RhaT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details PF06379: RhaT" amino acids 1 to 343 (343 residues), 715.7 bits, see alignment E=4.7e-220 TIGR00776: RhaT L-rhamnose-proton symporter family protein" amino acids 7 to 342 (336 residues), 365.5 bits, see alignment E=8.6e-114

Best Hits

Swiss-Prot: 94% identical to RHAT_KLEP3: L-rhamnose-proton symporter (rhaT) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_07510)

MetaCyc: 90% identical to rhamnose/lyxose:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-112; TRANS-RXN0-236

Predicted SEED Role

"L-rhamnose-proton symporter" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVM7 at UniProt or InterPro

Protein Sequence (344 amino acids)

>BWI76_RS00700 rhamnose/proton symporter RhaT (Klebsiella michiganensis M5al)
MNHAITMGIFWHLIGAASAACFYAPFKKVKHWSWETMWSIGGIVSWLILPWAISAMLLPD
FWSYYGSFDASTLLPVFLFGAMWGIGNINYGLTMRYLGMSMGIGIAIGITLIVGTLMTPI
LNGQFDVLINTKGGQMTLLGVLVAVIGVGIVTRAGQLKERKMGIKAEDFNLKKGLLLAVM
CGIFSAGMSFAMNAAKPMHEAAAALGVDPLYTALPSYVVIMGGGALVNLGFCFIRLAKVK
DLSIKADFSLAKPLIISNILLSALGGLMWYLQFFFYAWGHASIPAQYDYMSWMLHMSFYV
LCGGLVGLILKEWNNAGRRPVGVLSLGCVVIIIAANIVGLGMAN