Protein Info for BWI76_RS00665 in Klebsiella michiganensis M5al

Annotation: rhamnose ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 25 to 236 (212 residues), 25.6 bits, see alignment E=8.1e-10 TIGR02637: rhamnose ABC transporter, rhamnose-binding protein" amino acids 26 to 326 (301 residues), 452.6 bits, see alignment E=3.2e-140 PF13407: Peripla_BP_4" amino acids 26 to 286 (261 residues), 230.7 bits, see alignment E=2.2e-72

Best Hits

Swiss-Prot: 37% identical to LSRB_ECOLI: Autoinducer 2-binding protein LsrB (lsrB) from Escherichia coli (strain K12)

KEGG orthology group: K10559, rhamnose transport system substrate-binding protein (inferred from 97% identity to kpe:KPK_5471)

MetaCyc: 37% identical to Autoinducer-2 ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, substrate-binding component" in subsystem L-rhamnose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVM2 at UniProt or InterPro

Protein Sequence (328 amino acids)

>BWI76_RS00665 rhamnose ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MKTNTSLILTVAILALSGSALAEVKIALVAKSLGNGFFEAANVGAQEAAKELGDVKVIYT
GPTTTTAEAQIEVLNGLIAQGVDAIAISANDPDAVVPVLKKAMQRGIKVVSWDSGVAPAG
RQIHLNPSNNALIGETNVKLAADALKALNVEKGDVAILSATPTSTNQNIWIEEMKKVLPQ
YPSVNLVTVAYGDDLSDKSYREAVGLLKSYPDLKVIVSPSSVGIVAAAQAVKDQGKIGKV
YVTGLGLPSEMAGAIKSGASKSFAIWNPIDLGYAATYLADDLVKGTATKTEANMGKLGKV
KLDADGSGAMAEPFVYDASNIDKFSKIF