Protein Info for BWI76_RS00645 in Klebsiella michiganensis M5al
Annotation: lactaldehyde reductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 45% identical to ADH2_ECOLI: Probable alcohol dehydrogenase (yiaY) from Escherichia coli (strain K12)
KEGG orthology group: K00001, alcohol dehydrogenase [EC: 1.1.1.1] (inferred from 95% identity to kpu:KP1_0065)MetaCyc: 90% identical to L-lactaldehyde reductase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Lactaldehyde reductase. [EC: 1.1.1.77]
Predicted SEED Role
"Lactaldehyde dehydrogenase involved in fucose or rhamnose utilization (EC 1.2.1.22)" in subsystem L-fucose utilization or L-rhamnose utilization (EC 1.2.1.22)
MetaCyc Pathways
- superpathway of N-acetylneuraminate degradation (22/22 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
- mixed acid fermentation (16/16 steps found)
- superpathway of anaerobic sucrose degradation (18/19 steps found)
- heterolactic fermentation (16/18 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
- superpathway of fucose and rhamnose degradation (11/12 steps found)
- superpathway of glycol metabolism and degradation (7/7 steps found)
- (S)-propane-1,2-diol degradation (5/5 steps found)
- ethanolamine utilization (5/5 steps found)
- 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
- ethanol degradation II (3/3 steps found)
- pyruvate fermentation to ethanol I (3/3 steps found)
- pyruvate fermentation to ethanol III (3/3 steps found)
- ethanol degradation I (2/2 steps found)
- ethylene glycol degradation (2/2 steps found)
- pyruvate fermentation to ethanol II (2/2 steps found)
- acetylene degradation (anaerobic) (4/5 steps found)
- pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
- L-lactaldehyde degradation (anaerobic) (1/1 steps found)
- acetaldehyde biosynthesis I (1/1 steps found)
- phytol degradation (3/4 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-methionine degradation III (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- methylglyoxal degradation V (2/3 steps found)
- L-lactaldehyde degradation (aerobic) (1/2 steps found)
- lactate biosynthesis (archaea) (3/5 steps found)
- superpathway of methylglyoxal degradation (5/8 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- salidroside biosynthesis (2/4 steps found)
- methylglyoxal degradation IV (1/3 steps found)
- nucleoside and nucleotide degradation (halobacteria) (3/6 steps found)
- phenylethanol biosynthesis (2/5 steps found)
- L-rhamnose degradation II (4/8 steps found)
- methylglyoxal degradation VI (1/4 steps found)
- serotonin degradation (3/7 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
- butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
- noradrenaline and adrenaline degradation (4/13 steps found)
- L-tryptophan degradation V (side chain pathway) (1/13 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Drug metabolism - cytochrome P450
- Fatty acid metabolism
- Glycine, serine and threonine metabolism
- Glycolysis / Gluconeogenesis
- Glyoxylate and dicarboxylate metabolism
- Metabolism of xenobiotics by cytochrome P450
- Pyruvate metabolism
- Retinol metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.1, 1.1.1.77, 1.2.1.22
Use Curated BLAST to search for 1.1.1.1 or 1.1.1.77 or 1.2.1.22
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AVK0 at UniProt or InterPro
Protein Sequence (382 amino acids)
>BWI76_RS00645 lactaldehyde reductase (Klebsiella michiganensis M5al) MSFMLALPKISLHGAGAIGDMVKLVAGKRWGKALIVTDGQLVKLGLLDSLFAAMDEQQMA YHLFDEVFPNPTEALVQKGYAAYCEAGCDYLIAFGGGSPIDTAKAVKILTANPGPSTAYS GVGKVTNPGVPLVAINTTAGTAAEMTSNAVIIDAERQVKEVIIDPNIIPDIAVDDASVML DIPPAITAATGMDALTHAIEAFVSVGAHPLTDANAQEAIRLINLWLPKAVDDGHNLEARE QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIIENFNRPNAVSRFA RVAQAMGVDTRGMSDEAASMEAINAIRALSKRVGIPQGFSQLGVSKADIEGWLDKALADP CAPCNPRAASRDEVRELYLEAL