Protein Info for BWI76_RS00630 in Klebsiella michiganensis M5al

Annotation: sugar (glycoside-Pentoside-Hexuronide) transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 119 to 145 (27 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 239 to 264 (26 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 329 to 353 (25 residues), see Phobius details amino acids 374 to 399 (26 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 20 to 455 (436 residues), 409.5 bits, see alignment E=7.3e-127 PF13347: MFS_2" amino acids 22 to 441 (420 residues), 301.7 bits, see alignment E=7.3e-94 PF07690: MFS_1" amino acids 31 to 356 (326 residues), 34.8 bits, see alignment E=9.2e-13

Best Hits

Swiss-Prot: 46% identical to YICJ_ECOLI: Inner membrane symporter YicJ (yicJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to kva:Kvar_5015)

Predicted SEED Role

"Predicted beta-glucoside transporter, GPH family" in subsystem Beta-Glucoside Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVR0 at UniProt or InterPro

Protein Sequence (462 amino acids)

>BWI76_RS00630 sugar (glycoside-Pentoside-Hexuronide) transporter (Klebsiella michiganensis M5al)
MSATAMEKPGAYEKLGLREKIGYGMGDAGSGMIWSVLALYLTWFYTDVYGLNAGVVGTLF
LVIRIFDAFSDPLMGAICDRTVSRWGKFRPWLLWMAFPFGLGAVLMFTTPDLSMNGKIIY
AWVTYLVMSLIYTAINIPYCSVGGVITLNQKERMGCLSWRFFLNGLATLIISSSILPLTD
WLGNGDRASGFQLTMIIMGGAATLMFLFCFSSIKERVVSVKQNESLKKDLRDIIKNDQWL
LMISITFLNVFPAFIRGGVTIYYATYVMKASVGFITFFMALGVACNMLGSVLAKPLTDRF
DKLALFRVINIILGILSFALWFIDPQSLTPLMTLFVIINVLHLIQSGPILWAMMSDVDDY
GDWKFGKRLTGISFAGNLFMLKMGLAVAGAIVAWILAFTGYVANEPQQNSQTLQGIIVMF
SLLPMVSYFISAYLVRYFKLNNAFLERIKTDLAKRELEKGRG