Protein Info for BWI76_RS00595 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 21 to 37 (17 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 382 (355 residues), 212.8 bits, see alignment E=7e-67

Best Hits

KEGG orthology group: None (inferred from 89% identity to eae:EAE_07465)

Predicted SEED Role

"D-galactonate transporter" in subsystem D-galactonate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVJ2 at UniProt or InterPro

Protein Sequence (425 amino acids)

>BWI76_RS00595 MFS transporter (Klebsiella michiganensis M5al)
MSTVNQTSSAVIEPPKLSRRRWGIILILLLAAVVNYLDRANLSIANTTISKEFGFSGTEM
GLLLSAFLWPYALANLPAGWLVDRFGPKKMFTGALTLWSAVTFLMGFVNTYSFFYGLRVL
LGVAESPFFTSGIKITQSWFSDKERGLPTSIINTGSQIANAIAPPLLTLLLLWVGWRGMF
IAVGLLGIPLILAWLKFYRDPDAREAMLIHTGKVVMAEADKPQVSWGELFRNKTTWFMIS
GNFCIMFTIWVYLTWLPGYLETSLGFSLKQTGFIASIPFFAGILGVLCGGMLSDRLVRRG
INAVTARKVPIVVGAAMAACFVMPIPFVSNSGTAITLLTLGYFCSQMPSGVIWALAADMA
PKEQVASLGAIQNFGGFLGAALAPVITGIILDATGQFTNVFILGGCLLFLGACLYGFFVR
KPLAQ