Protein Info for BWI76_RS00580 in Klebsiella michiganensis M5al

Annotation: ribokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF08220: HTH_DeoR" amino acids 6 to 58 (53 residues), 45.6 bits, see alignment 7.2e-16 PF00294: PfkB" amino acids 101 to 390 (290 residues), 209 bits, see alignment E=1.6e-65 PF08543: Phos_pyr_kin" amino acids 274 to 383 (110 residues), 65.8 bits, see alignment E=6.3e-22

Best Hits

KEGG orthology group: None (inferred from 89% identity to eae:EAE_07450)

Predicted SEED Role

"Ribokinase (EC 2.7.1.15)" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism (EC 2.7.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.15

Use Curated BLAST to search for 2.7.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVQ1 at UniProt or InterPro

Protein Sequence (403 amino acids)

>BWI76_RS00580 ribokinase (Klebsiella michiganensis M5al)
MFLEERRKSILRYLDEHERGYVNYFSAHFNVTKETIRSDLNTLAAMGLVQRCYGGAIISR
RSLQAELISETGDSFEVLLQPLNHRKSPGDERQKGKVMQGKVCVFGSFNVDIVAKVERFP
RGGESLMALGSSLGPGGKGANQATAASKAGAQVHFVAKVGKDQFSHLAADHLTRSAIHSY
TLYQSESEPTGNAIIYVSQENGENMIAIYSGANTTITYSEIQKIIPELSSSDVLLVQLEN
NFDATHSLIKIAHELGKQVILNPAPYSAEIIPSIPFVDVITPNETEASLLSGIDISDFDT
AKEAALRIARLGAKKVLITMGSRGALLLDNRQFSHIRAFPAVTVDTTGAGDAFNGALAAS
LAAGNSLVQAATWASAFASLAVELEGASNMPEFEQANARLRTL