Protein Info for BWI76_RS00570 in Klebsiella michiganensis M5al

Annotation: AzlC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details PF03591: AzlC" amino acids 19 to 154 (136 residues), 105.2 bits, see alignment E=2e-34

Best Hits

KEGG orthology group: None (inferred from 90% identity to ent:Ent638_4080)

Predicted SEED Role

"FIG00350115: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVN7 at UniProt or InterPro

Protein Sequence (219 amino acids)

>BWI76_RS00570 AzlC family protein (Klebsiella michiganensis M5al)
MKQHFAALKGDTLRAIVLVCLAVGIVGMSYGSLAVAYGFPIWVPFVLSVCVLAGASEFMF
IGIVASGGNPLAAAAAGLLVNARHIPFGVTVRDLVGQRAASFLGCHIMNDESVVFGLSQK
TPEQRRAAYWLCGLGVALIWPLGALLGAGVGKLLPAPETIGLDAVFPAILLALVVPAFKN
RTTLIRACSGAALSLAAVPFAPVGLPVLLSLFGLLTRKK