Protein Info for BWI76_RS00500 in Klebsiella michiganensis M5al

Annotation: PTS sorbose IIC component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 56 to 85 (30 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 206 to 235 (30 residues), see Phobius details PF03609: EII-Sor" amino acids 3 to 233 (231 residues), 224.4 bits, see alignment E=7e-71

Best Hits

KEGG orthology group: K02795, PTS system, mannose-specific IIC component (inferred from 91% identity to cro:ROD_38601)

MetaCyc: 37% identical to fructoselysine/glucoselysine PTS enzyme IIC component (Salmonella enterica enterica serovar Typhimurium str. 14028S)
2.7.1.-; 2.7.1.-

Predicted SEED Role

"PTS system, mannose-specific IIC component"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVQ7 at UniProt or InterPro

Protein Sequence (267 amino acids)

>BWI76_RS00500 PTS sorbose IIC component (Klebsiella michiganensis M5al)
MLTSAILVAVIMFLVKTADHTLGQPLIERPLICGALVGLVLGDLQQGIIIGATLELIFLG
TITIGGSVPADLAVGSVLATAFTILTHAEPPVAVALALPISLLAVFVYQVLKLVYTALVE
KYDALLEQGRDRAALGLTLGMTFFYGIPFALIAFFGVLFGTEVIRSLVESIPGTVMRGMT
AVGGILPALGFAILLKALWNRNIAAFFFIGFAMAAYLQLPIMGIAIIAASVAVYLCFNEF
NQLKANKQTATAAAPASVDDKDGFFND