Protein Info for BWI76_RS00470 in Klebsiella michiganensis M5al

Annotation: sulfate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF04879: Molybdop_Fe4S4" amino acids 44 to 103 (60 residues), 62.2 bits, see alignment E=3.7e-21 PF00384: Molybdopterin" amino acids 107 to 175 (69 residues), 29 bits, see alignment E=5.7e-11

Best Hits

KEGG orthology group: K00123, formate dehydrogenase, alpha subunit [EC: 1.2.1.2] (inferred from 95% identity to ecv:APECO1_2571)

Predicted SEED Role

"Formate dehydrogenase O alpha subunit (EC 1.2.1.2) @ selenocysteine-containing" (EC 1.2.1.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVI1 at UniProt or InterPro

Protein Sequence (195 amino acids)

>BWI76_RS00470 sulfate ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MQVSRRQFFKICAGGMAGTTAAALGFAPGLALAETRQYKLLRTRETRNTCTYCSVGCGLL
MYSLGDGAKNAKASIFHIEGDPDHPVNRGALCPKGAGLVDFIHSESRLKFPEYRAPGSDK
WQQISWDEAFDRIAKLMKEDRDANFVAQNSEGTTVNRWLTTGMLCASASSNETGYLTQKF
TRALGMLAVDNQARV