Protein Info for BWI76_RS00455 in Klebsiella michiganensis M5al

Annotation: formate dehydrogenase cytochrome b556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details TIGR01583: formate dehydrogenase, gamma subunit" amino acids 7 to 204 (198 residues), 223.8 bits, see alignment E=1.1e-70 PF01292: Ni_hydr_CYTB" amino acids 9 to 184 (176 residues), 89.3 bits, see alignment E=1.4e-29

Best Hits

Swiss-Prot: 93% identical to FDOI_ECOLI: Formate dehydrogenase, cytochrome b556(fdo) subunit (fdoI) from Escherichia coli (strain K12)

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 93% identity to eum:ECUMN_4422)

MetaCyc: 93% identical to formate dehydrogenase O subunit gamma (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase O gamma subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVK6 at UniProt or InterPro

Protein Sequence (211 amino acids)

>BWI76_RS00455 formate dehydrogenase cytochrome b556 subunit (Klebsiella michiganensis M5al)
MKRRDTIVRYTAPERINHWVTAFCFVLAAVSGLGFFFPSFNWLMHIMGTPQLARILHPFV
GVIMFASFIIMFFRYWHHNLINRDDIFWAKNIRKIVVNEEVGDTGRYNFGQKCVFWAAII
FLVLLLVSGVIIWRPYFAPAFSIPVIRVALMLHSFSAVALIVVIMVHIYAALWVKGTITA
MVEGWVTKTWAKKHHPRWYREVREKQDKRQS