Protein Info for BWI76_RS00420 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 240 to 270 (31 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 18 to 275 (258 residues), 335.8 bits, see alignment E=1.1e-104 PF03631: Virul_fac_BrkB" amino acids 29 to 274 (246 residues), 199.1 bits, see alignment E=5.2e-63

Best Hits

Swiss-Prot: 92% identical to Y4136_KLEP7: UPF0761 membrane protein KPN78578_41360 (KPN78578_41360) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_07380)

Predicted SEED Role

"Inner membrane protein YihY, formerly thought to be RNase BN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVH7 at UniProt or InterPro

Protein Sequence (286 amino acids)

>BWI76_RS00420 hypothetical protein (Klebsiella michiganensis M5al)
MLKTVHQKTTRHLRPLVAWLKLLWRRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA
FPMFSDVSIQIRHFIFANFIPATGDVIQGYIEQFVANSSRMTAVGAFGLIVTSLLLMYSI
DSALNTIWRSTRTRPKTYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNSVIDDV
LRIFPLILSWVAFWLLYSIVPTAEVRNRDAIIGSLVAALLFEAGKKAFALYITAFPSYQL
IYGVLAVVPILFVWVYWTWCIVLLGAEITVTLGEYRKLKKEETEQS