Protein Info for BWI76_RS00400 in Klebsiella michiganensis M5al

Annotation: glutamine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 TIGR00653: glutamine synthetase, type I" amino acids 4 to 468 (465 residues), 722.9 bits, see alignment E=7.3e-222 PF03951: Gln-synt_N" amino acids 14 to 95 (82 residues), 111.9 bits, see alignment E=8.6e-37 PF00120: Gln-synt_C" amino acids 103 to 466 (364 residues), 468.4 bits, see alignment E=1.4e-144

Best Hits

Swiss-Prot: 95% identical to GLN1B_SALTY: Glutamine synthetase (glnA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 97% identity to enc:ECL_05111)

MetaCyc: 94% identical to glutamine synthetase (Escherichia coli K-12 substr. MG1655)
Glutamate--ammonia ligase. [EC: 6.3.1.2]

Predicted SEED Role

"Glutamine synthetase type I (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVG5 at UniProt or InterPro

Protein Sequence (469 amino acids)

>BWI76_RS00400 glutamine synthetase (Klebsiella michiganensis M5al)
MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPSHQVNAEFFEEGKMFDGSSIGGWKG
INESDMVLMPDATTALIDPFYEEPTLIIRCDILEPGTLQGYDRDPRSIAKRAEEYLRSTG
LADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNSSTKYEGGNKGHRPGVKGGY
FPVPPVDSSQDIRSTMCMIMEEMGLVVEAHHHEVATAGQNEIATRFNTMTKKADEIQIYK
YVVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLSKNGVNLFSGDKYAGLSEQALYYIG
GVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRSASIRIPVVTSPKARRIEVR
FPDPAANPYLCFAALLMAGLDGIKNKIHPGEAMDKNLYDLPPEEAKEIPQVAGSLEEALN
ALDADREFLTAGGVFTNDAIDAYIALRIEENDRVRMTPHPVEFELYYSV