Protein Info for BWI76_RS00350 in Klebsiella michiganensis M5al

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details PF01553: Acyltransferase" amino acids 75 to 193 (119 residues), 47.1 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 77% identical to YIHG_ECOLI: Probable acyltransferase YihG (yihG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to kva:Kvar_5053)

MetaCyc: 77% identical to 1-acylglycerol-3-phosphate O-acyltransferase YihG (Escherichia coli K-12 substr. MG1655)
1-acylglycerol-3-phosphate O-acyltransferase. [EC: 2.3.1.51]

Predicted SEED Role

"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.51

Use Curated BLAST to search for 2.3.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVH6 at UniProt or InterPro

Protein Sequence (299 amino acids)

>BWI76_RS00350 acyltransferase (Klebsiella michiganensis M5al)
MSRLLAAITLPLSIALTIVVTIICSVPIIIAGLIKLLVPVAAVWRSISVFCNFMMYCWCE
GLALLLRLNPWLKWDVEGLEGLNKKNWYLLISNHHSWADIVVLCVLFRKHIPMNKYFLKQ
QLAWVPFIGLACWALDMPFMRRYSRGYLIRHPERRGKDVETTRRSCEKFRSHPTTIVNFV
EGSRFTEEKRLQTRSPYNNLLAPKAAGTAMALSVLGSQFDKLLNVTLCYPENHHRPFYDM
LSGRLTRIVVRIRVEPVTEELHGDYVNDKNFKRRFQRWLNTLWENKDRQLTEIMQQKGK