Protein Info for BWI76_RS00335 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 PF06288: DUF1040" amino acids 1 to 86 (86 residues), 153.4 bits, see alignment E=9.1e-50

Best Hits

Swiss-Prot: 90% identical to YIHD_ECO57: Protein YihD (yihD) from Escherichia coli O157:H7

KEGG orthology group: K09896, hypothetical protein (inferred from 91% identity to cko:CKO_03156)

Predicted SEED Role

"Protein yihD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVF3 at UniProt or InterPro

Protein Sequence (89 amino acids)

>BWI76_RS00335 hypothetical protein (Klebsiella michiganensis M5al)
MKCKRLNEVIELLQPAWQKEPELNLIQFLQKLAKEAGYAGELSDLSDDILIYHLKMRDSA
KEAVIPGIQKDYEEDFKTALLRARGVIKE