Protein Info for BWI76_RS00285 in Klebsiella michiganensis M5al

Annotation: D-ribose ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 27 to 268 (242 residues), 94.1 bits, see alignment E=2.2e-30 PF13407: Peripla_BP_4" amino acids 29 to 281 (253 residues), 206.5 bits, see alignment E=1.1e-64 PF13458: Peripla_BP_6" amino acids 58 to 243 (186 residues), 36 bits, see alignment E=1.3e-12 PF13377: Peripla_BP_3" amino acids 159 to 286 (128 residues), 50.5 bits, see alignment E=5.3e-17

Best Hits

Swiss-Prot: 94% identical to RBSB_SALTI: Ribose import binding protein RbsB (rbsB) from Salmonella typhi

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 93% identity to eok:G2583_4547)

MetaCyc: 93% identical to ribose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVG6 at UniProt or InterPro

Protein Sequence (296 amino acids)

>BWI76_RS00285 D-ribose ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MNMKKLATLVSAVALSATVSANAMAKDTIALVISTLNNPFFVSLKEGAQKEADKLGYNLV
VLDSQNNPAKELANVQDLTVRGTKLLLINPTDSDAVGNAVKLANQAKIPVITLDRQASKG
DVVSHIASDNVLGGKMAGDYIAKKVGENAKIIELQGIAGTSAARERGEGFQQAVAAHKFN
VLASQPADFDRTKGLNVMQNLLTAHPDVQAVFAQNDEMALGALRALQTAGKSDVMVVGFD
GTPDGEKAVNSGKLAATIAQLPEQIGVKGVETADKVLKGEKVETSYPLELKLVIKQ