Protein Info for BWI76_RS00270 in Klebsiella michiganensis M5al
Updated annotation (from data): D-ribose pyranase (EC 5.4.99.62)
Rationale: Specifically important for utilizing D-Ribose. Automated validation from mutant phenotype: the predicted function (RXN0-5304) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: D-ribose pyranase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to RBSD_KLEP3: D-ribose pyranase (rbsD) from Klebsiella pneumoniae (strain 342)
KEGG orthology group: K06726, D-ribose pyranase [EC: 5.-.-.-] (inferred from 91% identity to kpn:KPN_04153)MetaCyc: 86% identical to D-ribose pyranase (Escherichia coli K-12 substr. MG1655)
RXN0-5304 [EC: 5.4.99.62]
Predicted SEED Role
"Ribose ABC transport system, high affinity permease RbsD (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)
MetaCyc Pathways
- ribose phosphorylation (2/2 steps found)
KEGG Metabolic Maps
- Biosynthesis of steroids
- Carotenoid biosynthesis - General
- Lipopolysaccharide biosynthesis
- Pentose and glucuronate interconversions
Isozymes
Compare fitness of predicted isozymes for: 5.-.-.-
Use Curated BLAST to search for 5.-.-.- or 5.4.99.62
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AVD9 at UniProt or InterPro
Protein Sequence (139 amino acids)
>BWI76_RS00270 D-ribose pyranase (EC 5.4.99.62) (Klebsiella michiganensis M5al) MKKGTVLNADISSVISRLGHTDTLVVCDAGLPVPRSSTRIDMALTHGVPSFMQVLEVVTS EMQVEVAILAEEIKTLNPQLHATLLNHLEQLQQHQGNTIEIRYTSHEQFKKETADSQAVI RSGECSPYANVILCAGVTF