Protein Info for BWI76_RS00265 in Klebsiella michiganensis M5al

Annotation: potassium transporter Kup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 49 to 69 (21 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details PF02705: K_trans" amino acids 13 to 463 (451 residues), 631.3 bits, see alignment E=7.6e-194 TIGR00794: potassium uptake protein" amino acids 97 to 550 (454 residues), 655.1 bits, see alignment E=7.1e-201 PF22776: K_trans_C" amino acids 474 to 622 (149 residues), 168.6 bits, see alignment E=8.6e-54

Best Hits

Swiss-Prot: 96% identical to KUP_KLEP7: Low affinity potassium transport system protein kup (kup) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K03549, KUP system potassium uptake protein (inferred from 93% identity to esc:Entcl_4406)

MetaCyc: 92% identical to K+:H+ symporter Kup (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-3

Predicted SEED Role

"Kup system potassium uptake protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVJ6 at UniProt or InterPro

Protein Sequence (622 amino acids)

>BWI76_RS00265 potassium transporter Kup (Klebsiella michiganensis M5al)
MSTDNKQSLPAITLAAIGVVYGDIGTSPLYTLRECLSGQFGFGVERDAVFGFLSLIFWLL
IFTVSLKYITFVMRADNAGEGGILTLMSLAGRNTSARATSVLVILGLIGGSFFYGEVVIT
PAISVMSAIEGLEIIAPDLDTWVVPISIIVLTLLFAIQKHGTSMVGKLFAPIMLIWFLLL
AVLGARSIFANPEVLQALNPYWAVHFFLEYKTVSFVALGAVVLSITGVEALYADMGHFGK
LPIRLAWFSVVLPSLVLNYFGQGALLLKHPEAIKNPFFLLAPEWALIPMLIIAALATVIA
SQAVISGVFSLTRQAVRLGYLSPMRIIHTSEMESGQIYIPFINWLLYISVVIVIVSFEHS
SNLAAAYGIAVTGTMVLTTILFTTVARQNWHWNKFVVALLLVAFMCIDVPLFSANLDKIV
SGGWLPLTLGLVMFTIMTTWKSERFRLLRRMHEHGNSLEAMISSLEKSPPVRVPGTAVYM
SRALNVIPFALLHNLKHNKVLHERVILLTLRTEDAPYVHNVRRVQIEQISPSFWRVVASY
GWRETPNVEEVFHRCGLEGLSCRMMETSFFMSHESLIIGKRPWYLRLRGKLYLLLQRNAL
RAPDQFEIPPNRVIELGTQVEI