Protein Info for BWI76_RS00260 in Klebsiella michiganensis M5al

Annotation: ATPase RavA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details PF20030: bpMoxR" amino acids 11 to 208 (198 residues), 190.9 bits, see alignment E=5.3e-60 PF07728: AAA_5" amino acids 42 to 171 (130 residues), 99.2 bits, see alignment E=7.6e-32 PF17868: AAA_lid_8" amino acids 227 to 293 (67 residues), 76 bits, see alignment E=5.6e-25 PF20265: LARA_dom" amino acids 335 to 436 (102 residues), 134.7 bits, see alignment E=5.2e-43 PF12592: ATPase_RavA_C" amino acids 444 to 498 (55 residues), 82.1 bits, see alignment 8.2e-27

Best Hits

Swiss-Prot: 84% identical to RAVA_SALNS: ATPase RavA (ravA) from Salmonella newport (strain SL254)

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 93% identity to kva:Kvar_5068)

MetaCyc: 80% identical to regulatory ATPase RavA (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Putative regulator protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVG0 at UniProt or InterPro

Protein Sequence (499 amino acids)

>BWI76_RS00260 ATPase RavA (Klebsiella michiganensis M5al)
MAQSHLLAERISRLSAALEKGLFERSHAIRLCLLAALSGESVFLLGPPGIAKSLIARRLK
FAFQQARAFEYLMTRFSTPEEVFGPLSIQALKDEGRYERLTAGYLPEAEIVFLDEIWKAG
PAILNTLLTAINERHFRNGATEEKIPMRLLVAASNELPEADNSLEALYDRMLIRLWLDKV
QDKTNFRSMLISQQDENSNPVPANLQVSDEEFLQWQQDIGNVKLPDSVFELIFQLRQQLD
TLPNAPYVSDRRWKKAIRLLQASAFFSGRDTIAPIDLILLKDCLWHNVETMNLMSAQLET
LMTSHAWQQQAMLTRLGSIIQRRIQLQQQQSDKTALKVTRLGGMFSRKPHYELPAEVQDS
TLTLLLQQPLKLHDLEVIHITFVREELAHWLEKGGEIRGKLNGIGFAQQLNMDVDTSQHL
VVRDVSLQGSRLSLPGSESRENMPAEIRQQLEALDDEWHQQHNRFSEQQKCLFIPGEWLG
RIEASLQDVGTQIKQARQS