Protein Info for BWI76_RS00170 in Klebsiella michiganensis M5al

Annotation: bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF01128: IspD" amino acids 6 to 47 (42 residues), 28.3 bits, see alignment 3.6e-10 TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase" amino acids 6 to 455 (450 residues), 682.2 bits, see alignment E=1.7e-209 PF00483: NTP_transferase" amino acids 8 to 213 (206 residues), 48.8 bits, see alignment E=1.8e-16 PF12804: NTP_transf_3" amino acids 8 to 121 (114 residues), 73.7 bits, see alignment E=5e-24 PF00132: Hexapep" amino acids 268 to 300 (33 residues), 31.5 bits, see alignment (E = 2.5e-11) amino acids 395 to 429 (35 residues), 37.3 bits, see alignment 3.6e-13 PF14602: Hexapep_2" amino acids 395 to 429 (35 residues), 32.8 bits, see alignment 1.1e-11

Best Hits

Swiss-Prot: 92% identical to GLMU_KLEP7: Bifunctional protein GlmU (glmU) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 93% identity to eae:EAE_07155)

MetaCyc: 88% identical to fused N-acetylglucosamine-1-phosphate uridyltransferase and glucosamine-1-phosphate acetyltransferase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylglucosamine diphosphorylase. [EC: 2.7.7.23]; Glucosamine-1-phosphate N-acetyltransferase. [EC: 2.7.7.23, 2.3.1.157]

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVC1 at UniProt or InterPro

Protein Sequence (456 amino acids)

>BWI76_RS00170 bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase (Klebsiella michiganensis M5al)
MSNSPMSVVILAAGKGTRMYSDLPKVLHSLAGKPMVQHVIDAAKELGASAVHLVYGHGGD
LLRQTLREDNLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPLISVETLQRLRDA
KPQGGIGLLTVKLDDPTGYGRITRDNGAVTGIVEHKDASEEQRRIQEINTGILVANGADL
KRWLAKLTNNNVQGEYYITDIIAMAYQEGREITAVHPRRLSEVEGVNNRLQLSRLERVWQ
SEQAEKLLLAGVMLRDPARFDLRGVLKHGRDVEIDTNVILEGDVVLGDRVKIGAGCVIKN
STIGDDCEISPYTVVEDAHLEAACTIGPFARLRPGAELLEGAHVGNFVEIKKARLGKGTK
AGHLSYLGDAEIGDNVNIGAGTITCNYDGANKHKTVIGDDVFVGSDSQLVAPVTVGNGVT
IAAGTTVTRDIADNELVLSRVPQVHKQGWQRPVKKK