Protein Info for BWI76_RS00160 in Klebsiella michiganensis M5al

Annotation: phosphate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF12849: PBP_like_2" amino acids 26 to 306 (281 residues), 124.9 bits, see alignment E=2.5e-40 TIGR00975: phosphate ABC transporter, phosphate-binding protein PstS" amino acids 29 to 335 (307 residues), 415.8 bits, see alignment E=5.1e-129

Best Hits

Swiss-Prot: 89% identical to PSTS_ECOLI: Phosphate-binding protein PstS (pstS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_07140)

MetaCyc: 89% identical to phosphate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVH3 at UniProt or InterPro

Protein Sequence (346 amino acids)

>BWI76_RS00160 phosphate ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MNVMRTTVATVVAATLSMSAFSVFAAASLTGAGATFPAPVYAKWADTYNKETGNKVNYQG
IGSSGGVKQITANTVDFGASDAPLADDKLAQEGLFQFPTVIGGVVLAINLPGVKSGELVL
DGKTLGDIYLGKIKKWDDAAIAKLNPGMKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEE
WKSKIGAGSTVNWPTGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNNLAYTKLLSADGK
PVSPTEDNFANAAKEIDWSKSFAQDLTNQKGDNAWPITSTTFILVHKASNKPEQTAEVLK
FFDWAYKNGGKEANALDYATLPESVVEQVRAAWKTNVKDSSGKALY