Protein Info for BWI76_RS00150 in Klebsiella michiganensis M5al

Annotation: phosphate transporter permease subunit PtsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 28 to 293 (266 residues), 282.9 bits, see alignment E=1.1e-88 PF00528: BPD_transp_1" amino acids 101 to 289 (189 residues), 97.4 bits, see alignment E=4.5e-32

Best Hits

Swiss-Prot: 95% identical to PSTA_ECOLI: Phosphate transport system permease protein PstA (pstA) from Escherichia coli (strain K12)

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 95% identity to ecy:ECSE_4012)

MetaCyc: 95% identical to phosphate ABC transporter membrane subunit PstA (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVE3 at UniProt or InterPro

Protein Sequence (296 amino acids)

>BWI76_RS00150 phosphate transporter permease subunit PtsA (Klebsiella michiganensis M5al)
MATIELQTTAELAESRRKMQAKRRMKNRLALTLSMATMAFGLFWLIWILMSTVTRGIDGM
SLALFTEMTPPPNTAGGGLANALAGSGLLILWSTVIGTPLGILAGIYLAEYGRKSWLAEV
IRFINDILLSAPSIVVGLFVYTIVVAQMQHFSGWAGVIALALLQVPIVIRTTENMLKLVP
DSLREAAYALGTPKWRMISAITLKASVSGIMTGILLAIARIAGETAPLLFTALSNQFWST
DMMQPIANLPVTIFKFAMSPFAEWQQLAWAGVLIITLCVLLLNILARVIFAKNKHG